Home > Product > Antimicrobial Peptides > Psychimicin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Psychimicin

[Price Inquiry]
CAT#
AF3152
Sequence
INNWVRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGGMQCYRR
Host Chemicals
Oiketicus kirbyi
Length
45
Activity
Antibacterial, Antifungal
SwissProt ID
P83421
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.