Home > Product > Antimicrobial Peptides > Psyle E

Antimicrobial Peptides

CAT#
AF2043
Sequence
GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
Host Chemicals
Psychotria leptothyrsa
Length
31
Activity
Anticancer
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.