Home > Product > Catalog Peptides > Others > pTH (1-31) amide (human)

Others

pTH (1-31) amide (human)

[Price Inquiry]
CAT#
P03022
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV-NH2
M.W/Mr.
3718.37
Molecular Formula
C162H270N50O46S2
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.