Home > Product > Catalog Peptides > Others > pTH (18-48) (human)

Others

pTH (18-48) (human)

Price Inquiry
CAT#
P03018
Sequence
MERVEWLRKKLQDVHNFVALGAPLAPRDAGS
M.W/Mr.
3505.07
Molecular Formula
C156H251N47O43S
Length
31

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.