CAT# | P03018 |
M.F/Formula | C156H251N47O43S |
M.W/Mr. | 3505.07 |
Sequence | MERVEWLRKKLQDVHNFVALGAPLAPRDAGS |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
An overview of trifluoroacetyl tripeptide-2 Peptides are chains of amino acids joined by peptide bond. Peptides are mostly i ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...