Home > Product > Catalog Peptides > Others > pTH (1-31) (human)

Others

pTH (1-31) (human)

[Price Inquiry]
CAT#
P03023
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV
M.W/Mr.
3719.35
Molecular Formula
C162H269N49O47S2
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.