Various Products / Cancer Research

pTH (1-31) (human)

Price Inquiry
CAT#
P03023
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV
M.W/Mr.
3719.35
Molecular Formula
C162H269N49O47S2
Length
31

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.