Home > Product > Catalog Peptides > Others > pTH (1-37) (human)

Others

warning All products are for research use only. Not for human use.

pTH (1-37) (human)

[Price Inquiry]
CAT#
P03039
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL
M.W/Mr.
4401.15
Molecular Formula
C195H316N58O54S2
Length
37
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.