Home > Product > Catalog Peptides > Others > pTH (1-34) (porcine)

Others

pTH (1-34) (porcine)

[Price Inquiry]
CAT#
P03029
Sequence
SVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNF
M.W/Mr.
4072.71
Molecular Formula
C181H292N54O51S
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.