Home > Product > Antimicrobial Peptides > Putative antimicrobial peptide

Antimicrobial Peptides

Putative antimicrobial peptide

Price Inquiry
CAT#
AF2999
Sequence
GFWSKIKDFAKKAWNSPLANELKSKALNAAKNFVSEKIGATPS
Host Chemicals
Opisthacanthus cayaporum
Length
43
Activity
Antimicrobial
SwissProt ID
C7C1L2

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.