Home > Product > Antimicrobial Peptides > Putative antimicrobial peptide

Antimicrobial Peptides

Putative antimicrobial peptide

[Price Inquiry]
CAT#
AF2999
Sequence
GFWSKIKDFAKKAWNSPLANELKSKALNAAKNFVSEKIGATPS
Host Chemicals
Opisthacanthus cayaporum
Length
43
Activity
Antimicrobial
SwissProt ID
C7C1L2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.