Home > Product > Catalog Peptides > Others > Putative exported peptide yydF

Others

Putative exported peptide yydF

Price Inquiry
CAT#
P36009
Sequence
MKKEITNNETVKNLEFKGLLDESQKLAKVNDLWYFVKSKENRWILGSGH
Length
49

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.