Home > Product > Catalog Peptides > Others > Putative exported peptide yydF

Others

Putative exported peptide yydF

[Price Inquiry]
CAT#
P36009
Sequence
MKKEITNNETVKNLEFKGLLDESQKLAKVNDLWYFVKSKENRWILGSGH
Length
49
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.