Home > Product > Catalog Peptides > Others > Putative peptide YY-3

Others

Putative peptide YY-3

[Price Inquiry]
CAT#
P36001
Sequence
ALVDTCPIKPEAPGEDESLEELSHYYASLCHYLNVVTRQWWEGADMW
Length
47
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.