Home > Product > Catalog Peptides > Others > Putative rho operon leader peptide

Others

warning All products are for research use only. Not for human use.

Putative rho operon leader peptide

[Price Inquiry]
CAT#
P36008
Sequence
MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.