Home > Product > Antimicrobial Peptides > Px-cec1

Antimicrobial Peptides

CAT#
AF2790
Sequence
KPFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIARPTGK
Host Chemicals
Plutella xylostella L
Length
39
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.