Keywords Search Google Search Search

Px-cec1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2790
Sequence	KPFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIARPTGK
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF3038	Bacteriocin microcin B17	Inquiry
AF991	Lividin-1-RA peptide precursor	Inquiry
AF1215	Prepromelittin-related peptide	Inquiry
AF1926	Oxt 4a	Inquiry
AF2115	Brevinin-2CG1 antimicrobial peptide precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

Function of PMX-53 as an antagonists

PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...

GaTx2, a Peptide Inhibitor of ClC-2 Chloride Channels

ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...

Function of (d(CH2)51, Tyr(Me)2, Arg8)-vasopressin in hyponatremia, ventricular tachycardia and defibrillation

(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...

Tachykinin NK2 receptor antagonist-MEN 10376

MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Plutella xylostella L
Length	39