Home > Product > Antimicrobial Peptides > Pyrularia thionin

Antimicrobial Peptides

Pyrularia thionin

Price Inquiry
CAT#
AF3221
Sequence
KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK
Host Chemicals
nuts, Pyrularia pubera
Length
47
Activity
Gram+ & Gram-, Mammalian cells, Cancer cells
SwissProt ID
SwissProt ID: P07504

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.