Keywords Search Google Search Search

Ranatuerin-1Cb antimicrobial peptide

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2572
Sequence	FTMKKSLLPLFFLGTITLSLCEQERGADEEEGNGEKE
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF2192	Tricyclon A	Inquiry
AF2456	Vicin-like antimicrobial peptide 2a	Inquiry
AF1285	Brevinin-1CG2	Inquiry
AF1018	Brevinin-2SN4 antimicrobial peptide precursor	Inquiry
AF2822	Beta-defensin 7 , BNBD-7	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

Function of phosphoramidon as an endothelin converting enzyme inhibitor

Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

Delmitide: A novel peptide with anti-inflammatory effect

Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...

The effect of terlipressin acetate in the treatment of decompensated liver cirrhosis

Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Rana catesbeiana
Length	37
SwissProt ID	C5IAZ5