Home > Product > Antimicrobial Peptides > Ranatuerin-1Cb antimicrobial peptide

Antimicrobial Peptides

Ranatuerin-1Cb antimicrobial peptide

[Price Inquiry]
CAT#
AF2572
Sequence
FTMKKSLLPLFFLGTITLSLCEQERGADEEEGNGEKE
Host Chemicals
Rana catesbeiana
Length
37
Activity
Antimicrobial
SwissProt ID
C5IAZ5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.