Home > Product > Antimicrobial Peptides > Ranatuerin-2C antimicrobial peptide

Antimicrobial Peptides

Ranatuerin-2C antimicrobial peptide

[Price Inquiry]
CAT#
AF3084
Sequence
FTVKKSLLLLFFLGTITLSFCEQERGADEDNGGEMTEEEVKRGV
Host Chemicals
Rana catesbeiana
Length
44
Activity
Antimicrobial
SwissProt ID
C5IB06
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.