Home > Product > Antimicrobial Peptides > Raphanus Sativus Antifungal Protein 2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Raphanus Sativus Antifungal Protein 2

[Price Inquiry]
CAT#
AF2531
Sequence
QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSC
Host Chemicals
Raphanus sativus var. niger
Length
36
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.