CAT# | AF2998 |
Sequence | GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...