Home > Product > Antimicrobial Peptides > Recombinant Crassostrea Gigas Defensin

Antimicrobial Peptides

Recombinant Crassostrea Gigas Defensin

[Price Inquiry]
CAT#
AF2998
Sequence
GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK
Host Chemicals
Crassostrea gigas
Length
43
Activity
Antibacterial, Antifungal
SwissProt ID
Q4GWV4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.