Antimicrobial Peptides

CAT#
AF2371
Sequence
KPYCSCKWRCGIGEEEKGICHKFPIVTYVCCRRP
Host Chemicals
Oryctolagus cuniculus
Length
34
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.