Home > Product > Antimicrobial Peptides > RprDefC

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2981
Sequence
ATCDLFSFRSKWVTPNHAGCAAHCIFLGNRGGRCVGTVCHCRK
Host Chemicals
Rhodnius prolixus
Length
43
Activity
Antbacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.