Home > Product > Antimicrobial Peptides > RprDefC

Antimicrobial Peptides

CAT#
AF2981
Sequence
ATCDLFSFRSKWVTPNHAGCAAHCIFLGNRGGRCVGTVCHCRK
Host Chemicals
Rhodnius prolixus
Length
43
Activity
Antbacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.