CAT# | AF3284 |
Sequence | QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC |
Activity | Fungi, |
Host Chemicals | Radish seeds, Raphanus sativus, Brassicaceae species | Length | 51 | SwissProt ID | PDB ID: 1AYJ |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF906 | Temporin-1SKc | Inquiry | ||
AF3164 | Ee-CBP | Inquiry | ||
AF1853 | AC-AMP1 | Inquiry | ||
AF461 | Aurein 2.2 | Inquiry | ||
AF3265 | Sm-AMP-D2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...