Home > Product > Antimicrobial Peptides > Rs-AFP1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3284
Sequence
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Host Chemicals
Radish seeds, Raphanus sativus, Brassicaceae species
Length
51
Activity
Fungi,
SwissProt ID
PDB ID: 1AYJ
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.