Home > Product > Antimicrobial Peptides > Rs-AFP2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3287
Sequence
QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Host Chemicals
radish seeds, Raphanus sativus, Brassicaceae species
Length
51
Activity
Fungi,
SwissProt ID
SwissProt ID: P30226
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.