Home > Product > Antimicrobial Peptides > Rs-AFP2

Antimicrobial Peptides

CAT#
AF3287
Sequence
QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Host Chemicals
radish seeds, Raphanus sativus, Brassicaceae species
Length
51
Activity
Fungi,
SwissProt ID
SwissProt ID: P30226
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.