Home > Product > Antimicrobial Peptides > Rs-AFP4

Antimicrobial Peptides

CAT#
AF3286
Sequence
QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICYFPC
Host Chemicals
radish, Raphanus sativus
Length
51
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.