Home > Product > Antimicrobial Peptides > Rugosin-B

Antimicrobial Peptides

CAT#
AF2306
Sequence
SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC
Host Chemicals
Rana rugosa
Length
33
Activity
Antibacterial
SwissProt ID
P80955
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.