Home > Product > Antimicrobial Peptides > Rugosin-C

Antimicrobial Peptides

CAT#
AF2600
Sequence
GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC
Host Chemicals
Rana rugosa
Length
37
Activity
Antibacterial
SwissProt ID
P80956
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.