Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2927
Sequence
ASFPWSCPSLSGVCRKVCLPTELFFGPLGCGKGFLCGVSHFL
Host Chemicals
Sparus aurata
Length
42
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.