Home > Product > Antimicrobial Peptides > Sakacin A

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2865
Sequence
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGKAGM
Host Chemicals
Lactobacillus sake Lb 706
Length
41
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.