Home > Product > Antimicrobial Peptides > Sakacin G immunity protein

Antimicrobial Peptides

Sakacin G immunity protein

[Price Inquiry]
CAT#
AF2651
Sequence
KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC
Host Chemicals
Lactobacillus sakei 2512
Length
37
Activity
Antibacterial
SwissProt ID
B2LS02
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.