Home > Product > Antimicrobial Peptides > Salivaricin P

Antimicrobial Peptides

Salivaricin P

[Price Inquiry]
CAT#
AF3153
Sequence
KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL
Host Chemicals
Lactobacillus salivarius DPC6005
Length
45
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.