Home > Product > Antimicrobial Peptides > Sarcotoxin-1D

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Sarcotoxin-1D

[Price Inquiry]
CAT#
AF2831
Sequence
GWIRDFGKRIERVGQHTRDATIQTIAVAQQAANVAATLKG
Host Chemicals
Sarcophaga peregrina
Length
40
Activity
Antibacterial
SwissProt ID
P18312
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.