Home > Product > Antimicrobial Peptides > Scarabaecin

Antimicrobial Peptides

Scarabaecin

[Price Inquiry]
CAT#
AF2495
Sequence
ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS
Host Chemicals
Oryctes rhinoceros
Length
36
Activity
Antibacterial, Antifungal
SwissProt ID
Q86SC0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.