Home > Product > Antimicrobial Peptides > Scorpion defensin

Antimicrobial Peptides

Scorpion defensin

[Price Inquiry]
CAT#
AF2578
Sequence
GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCCYRN
Host Chemicals
Leiurus quinquestriatus
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.