Home > Product > Catalog Peptides > Others > Scyllatoxin

Others

Scyllatoxin

[Price Inquiry]
CAT#
C27006
Sequence
AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2
M.W/Mr.
3423.1
Molecular Formula
C142H237N45O39S7
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.