Home > Product > Catalog Peptides > Others > Scyllatoxin

Others

Scyllatoxin

Price Inquiry
CAT#
C27006
Sequence
AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2
M.W/Mr.
3423.1
Molecular Formula
C142H237N45O39S7
Length
31

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.