Keywords Search Google Search Search

Sd1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3256
Sequence	RYCLSQSHRFKGLCMSSSNCANVCQTENFPGGECKADGATRKCFCKKIC
Activity	Fungi,

CAT#	Product Name	Inquiry
AF2227	Brevinin-2JD	Inquiry
AF1705	Ranatuerin-2AVa	Inquiry
AF1370	Grammistin Pp4b	Inquiry
AF2059	Lantibiotic epilancin	Inquiry
AF2525	B-defensin2-like protein 1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of propofol in anaesthesia

Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...

Bombesin and Bombesin-like peptides

Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...

Inhibitors of Aspartic Proteases-Acetyl Pepstatin

Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...

Difopein, a high affinity inhibitor of 14-3-3 proteins

The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...

Function of pergolide mesylate salt in Parkinson's disease

Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Sugarcane, Saccharum officinarum
Length	49