Antimicrobial Peptides

CAT#
AF3256
Sequence
RYCLSQSHRFKGLCMSSSNCANVCQTENFPGGECKADGATRKCFCKKIC
Host Chemicals
Sugarcane, Saccharum officinarum
Length
49
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.