Home > Product > Catalog Peptides > Others > Secretoneurin

Others

Secretoneurin

[Price Inquiry]
CAT#
C45002
Sequence
TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.