Home > Product > Antimicrobial Peptides > Seed non-specific lipid transfer protein-like

Antimicrobial Peptides

Seed non-specific lipid transfer protein-like

[Price Inquiry]
CAT#
AF2976
Sequence
ALSCGTVNSNLAACIGYLTQNAPLARGCCTGVTNLNNMAXTTP
Host Chemicals
Raphanus sativus
Length
43
Activity
Antifungal
SwissProt ID
P29420
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.