Home > Product > Catalog Peptides > Others > serine protease inhibitor pi-4A

Others

serine protease inhibitor pi-4A

[Price Inquiry]
CAT#
P15015
Sequence
EKECTPGETKKLDCNTCFCSDSGIWGCTLMGCRTYTLQPAPTPGEEATRV
Length
50
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.