Home > Product > Antimicrobial Peptides > SIalpha2

Antimicrobial Peptides

CAT#
AF3234
Sequence
RVCMKGSAGFKGLCMRDQNCAQVCLQEGWGGGNCDGVMRQCKCIRQC
Host Chemicals
seeds, Sorghum bicolor
Length
47
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.