Home > Product > Catalog Peptides > Others > Skin peptide tyrosine-tyrosine

Others

Skin peptide tyrosine-tyrosine

[Price Inquiry]
CAT#
S15001
Sequence
YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY
Modifications
Tyrosine amide
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.