Antimicrobial Peptides

CAT#
AF2109
Sequence
GTTVVNSTFSIVLGNKGYICTVTVECMRNCSK
Host Chemicals
Streptococcus mutans GS5
Length
32
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.