Antimicrobial Peptides

CAT#
AF3175
Sequence
AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE
Host Chemicals
Stomoxys calcitrans
Length
46
Activity
Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.