Home > Product > Antimicrobial Peptides > So-D2

Antimicrobial Peptides

CAT#
AF3294
Sequence
GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC
Host Chemicals
leaf, Spinacia oleracea
Length
52
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.