CAT# | AF2162 |
Sequence | VHISHQEARGPSFKICVGFLGPRWARGCSTGN |
Activity | Antimicrobial |
Host Chemicals | Pan troglodytes | Length | 32 | SwissProt ID | Q9MZ28 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3034 | Lunasin | Inquiry | ||
AF088 | Temporin H | Inquiry | ||
AF1363 | Brevinin-1-OR4 | Inquiry | ||
AF1826 | Oxyopinin-4a | Inquiry | ||
AF2933 | Proline-rich antimicrobial peptide 2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
2. Cationic cell-penetrating peptides are potent furin inhibitors
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...