Home > Product > Antimicrobial Peptides > Sperm associated antigen 11 isoform B

Antimicrobial Peptides

Sperm associated antigen 11 isoform B

[Price Inquiry]
CAT#
AF2162
Sequence
VHISHQEARGPSFKICVGFLGPRWARGCSTGN
Host Chemicals
Pan troglodytes
Length
32
Activity
Antimicrobial
SwissProt ID
Q9MZ28
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.