Home > Product > Antimicrobial Peptides > Sperm-associated antigen 11 variant E

Antimicrobial Peptides

Sperm-associated antigen 11 variant E

[Price Inquiry]
CAT#
AF2458
Sequence
RDVICLTQHGTCRLFFCHFGERKAEICSDPWNRCC
Host Chemicals
Canis lupus familiaris
Length
35
Activity
Antimicrobial
SwissProt ID
Q30KR2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.