Home > Product > Antimicrobial Peptides > Spheniscin-1

Antimicrobial Peptides

Spheniscin-1

[Price Inquiry]
CAT#
AF2749
Sequence
SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW
Host Chemicals
Aptenodytes patagonicus
Length
38
Activity
Antibacterial, Antifungal
SwissProt ID
P83429
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.