Home > Product > Antimicrobial Peptides > Spodomicin

Antimicrobial Peptides

Spodomicin

Price Inquiry
CAT#
AF2858
Sequence
VHVGPCDQVCSRIDPEKDECCRAHGYRGHSSCYYGRMECY
Host Chemicals
Spodoptera littoralis
Length
40
Activity
Antifungal
SwissProt ID
P83411

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.