Home > Product > Antimicrobial Peptides > Spodomicin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Spodomicin

[Price Inquiry]
CAT#
AF2858
Sequence
VHVGPCDQVCSRIDPEKDECCRAHGYRGHSSCYYGRMECY
Host Chemicals
Spodoptera littoralis
Length
40
Activity
Antifungal
SwissProt ID
P83411
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.