Home > Product > Antimicrobial Peptides > Staphylococcin C55

Antimicrobial Peptides

Staphylococcin C55

[Price Inquiry]
CAT#
AF1883
Sequence
CSTNTFSLSDYWGNKGNWCTATHECMSWCK
Host Chemicals
Staphylococcus aureus C55
Length
30
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.