Home > Product > Catalog Peptides > Others > Statherin

Others

CAT#
H20003
Sequence
DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
Modifications
Phosphoserine(2,3)
Length
43
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.