Home > Product > Antimicrobial Peptides > Strongylocin 1

Antimicrobial Peptides

Strongylocin 1

[Price Inquiry]
CAT#
AF3245
Sequence
IFGSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPQT
Host Chemicals
Strongylocentrotus droebachiensis
Length
48
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.