Home > Product > Catalog Peptides > Others > Styelin-C

Others

CAT#
S17003
Sequence
GWFGKAFRSVSNFYKKHKTYIHAGLSAATLL
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.