Home > Product > Catalog Peptides > Others > Styelin-C

Others

warning All products are for research use only. Not for human use.
CAT#
S17003
Sequence
GWFGKAFRSVSNFYKKHKTYIHAGLSAATLL
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.