Home > Product > Catalog Peptides > Others > Styelin-D

Others

warning All products are for research use only. Not for human use.
CAT#
S17004
Sequence
GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL
Modifications
Leucine amide;6'-bromotryptophan(2);3,4-dihydroxyarginine(4);4,5-dihydroxylysine;3',4'-dihydroxyphenylalanine;5-hydroxylysine;
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.